SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7E3U7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E3U7
Domain Number 1 Region: 263-398
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.09e-33
Family Canonical RBD 0.0000964
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7E3U7
Sequence length 673
Comment (tr|F7E3U7|F7E3U7_MONDO) Splicing factor proline and glutamine rich {ECO:0000313|Ensembl:ENSMODP00000022371} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=SFPQ OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MSRDRFRSRGGGGGGFHRRGGGGGRGGGLSHDFRSPPPGMGLSQNRGPLGPGPVQTGPKP
SIPPPPAQQQQASSPDPPKPGLPPGSSPGPTVGTAAPASVSAPSAPPPGSGGPSGPGSAS
SQASSGPSAPPGAPQQSSSTPAVSSASSGGPPPPPPGAAGPKPGPSPGGPKGKMPGGPKP
GGPGLTPSGGHQKPPHRGGGEPRGGRQHHPPYHQQQPPPPPHHQGPSPGGPTGRSEEKIS
DSEGFKANLSLLRRPGEKTYTQRCRLFVGNLPADITDEDFKRLFAKYGEPGEVFINKGKG
FGFIKLESRALAEIAKAELDDTPMRGRQLRVRFATHAAALSVRNLSPYVSNELLEEAFSQ
FGPIERAVVIVDDRGRSTGKGIVEFASKPAARKAFERCSEGVFLLTTTPRPVIVEPLEQL
DDEDGLPEKLAQKNPMYQKERENPPRFAQHGTFEFEYSQRWKSLDEMEKQQREQVEKNMK
DAKDKLESEMEDAYHEHQANLLRQDLMRRQEELRRMEELHNQEMQKRKEIQLRQEEERRR
REEEMMIRQREMEEQMRRQREESYSRMGYMDPREREIRMGGAAAMNMGDPYGSGSQKFPP
LGGGGIGYEASPGVPPTALSGSMMGSDMRTERFGQGGAGPVGGQGPRGMGPGTPAGYGRG
REEYEGPNKKPRF
Download sequence
Identical sequences F7E3U7
ENSMODP00000022371 ENSMODP00000022371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]