SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7E589 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E589
Domain Number 1 Region: 75-201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000173
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7E589
Sequence length 243
Comment (tr|F7E589|F7E589_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000019209} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
SISNKELSELIEQLQRNADQVEKNIVDTDAKMQADLAQIKEGRPAQYRDVAIQKVSDSEK
LLYVLEADAAIAKHMKHPQGDMITEDIRQLKGRVANLREKHNQIYTLTAKEVNPPVNWDS
VVNEKLGSLKGQTFGTDLPLVDQQVEEHNIFHNEVKAIGPHVNKDGDKRRSLLLSSVPAQ
AGSQERQQHLSSLQDYMQRCTNELYWLDQQAKGRMQYDWSDRNLDYPSRRRQYENFINRN
LES
Download sequence
Identical sequences F7E589
ENSOANP00000019209 ENSOANP00000019209 9258.ENSOANP00000019209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]