SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7E9P4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7E9P4
Domain Number 1 Region: 746-975
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.07e-53
Family DBL homology domain (DH-domain) 0.0000000163
Further Details:      
 
Domain Number 2 Region: 980-1107
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-38
Family Pleckstrin-homology domain (PH domain) 0.0000016
Further Details:      
 
Domain Number 3 Region: 345-517
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-32
Family Regulator of G-protein signaling, RGS 0.00000158
Further Details:      
 
Domain Number 4 Region: 42-122
Classification Level Classification E-value
Superfamily PDZ domain-like 1.05e-20
Family PDZ domain 0.025
Further Details:      
 
Weak hits

Sequence:  F7E9P4
Domain Number - Region: 151-231
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0654
Family Formin homology 2 domain (FH2 domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7E9P4
Sequence length 1497
Comment (tr|F7E9P4|F7E9P4_XENTR) Rho guanine nucleotide exchange factor 11 {ECO:0000313|Ensembl:ENSXETP00000051338} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=arhgef11 OC=Silurana.
Sequence
MVITIIFLFGRLSSLSSASDGAAERRSPGHQRQPCESNESTGLVQRCVIVQRDQNGFGFT
VSGDRIVLVQSVRPGGAAMRAGVQEGDRIVKVNGTLVANSSHIEVVKLIKSGAYVALTLL
GSPPPSMGISGYPQDLSTSVSPRNISVLPMPPPPPPPLPQMHHITGPKPLQDPDFQKHAT
EILWNMLKQEEADLQNLCDVYNKSPNSSLQEQIERARKRVHQLQHKIRQEIPGTGDLLRS
YSDCSSLGYKGRLSVDSQDGDSGLDSGTERISSLSEYSMNRNSVLSDLGMDSSHTSPIIP
TKLYRRQGSDTAFIATSEQVSDPMKSTIICPEEDYDHGYYMTELDGLFQDLERLKTRPAH
MGVFLRYIFSQADPNPLLFYLCAEACQHLSPTDAFPLRKEVWNIFLDKSAPLRIKIPETA
TWDGQSRPLNINVANCYSYRMYEIFALLVNSRTKRTMGLGSLYGENDLLDLEIDPHRERQ
VAAKQIAQLEDILSKYEKEISSPMAFALNMYVKYAGIHTQDIRPASTSEKSQSIPDREKW
LPFFPKNKKSSNAKKEDKSAEDKKRNPILKYINKPKSTSQSTFHVPLSPGEVKPGNVRNI
IQHFENNQQYDVPEHNLQRLSTGSFPEDLLDSDGTRLEVKLGRSESLKGREELKKSRKVD
NVPRSRSDVDMDAAAEATRLHQSASSSASSLSARSLDNPTPPYTPKLCRRSIESPNLGFT
GELLLSNLQEDDLGHLSDLDPEPDAQNWQHTVGRDVALHLLPKERARQEVIHAPELFVTE
ASHLRVLRVLDLIFYQRMRKENLLTPDELWLVFPNLPELIEIHNSLAESMKRLREEGPVI
KEIGDLMLLRFDGAAGEEVRMEAAKFCSYQISALELIKAKKRKETRFSLFMQEAESNPQC
RRLQLKDLIVSEMQRLTKYPLLLENVLKHTESGTQEHEKLYRCRDRCRDILKFVNESVKQ
AENEHRLAEYQKRLDASHLERSNNPLAAEFKNLDLTTRRMIHEGPLTWRVRDKTIDLHVL
LLEDLLVLLQKQDEKLVLKCHSKTTTDTKQTFSPVIKLNSVLVRSVATDKKALFIICTSD
LGPQIYELVALTSSEKNTWMDLLEEATNGAMRNPPGATKRKSQDINRPTSASMVLQRAHM
PKLTAEGVLRHNSEDPQSGSGDEGAGEFLGQKPDVVLEEPEREDDEDDEARTPTLLPIPS
KEEDAGGGTRGLDSSNHIPYHWPEVTEGLAESALDDVHNLRRLILKNMLHHGHSEYDSSS
APVAEPEDDLTPTPSVIGGHGHPWDTMTDAVLENRSESSRSVLNFPHGERPGSRDGEETA
WSLVERYPQSSSVQQNQSEQLHSEDHNNRSYRVVRKAEVVGNYDVISLPDSSQSQSVLQE
AGGGAIVDGNFFYVTASATSTKEDPEVSESLTNSDRLSSPSFLESRESNHTPTYQSEFST
PPPRSTESDPLLSDLLPPKLVIQDVDIIFRTIEHLTAKLHRLKEVESAHQELLRSLG
Download sequence
Identical sequences F7E9P4
ENSXETP00000051338 ENSXETP00000051338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]