SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EBB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EBB8
Domain Number 1 Region: 175-279
Classification Level Classification E-value
Superfamily SRCR-like 1.07e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 57-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-34
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 3 Region: 305-408
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-32
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 4 Region: 3-54
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-17
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7EBB8
Sequence length 696
Comment (tr|F7EBB8|F7EBB8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000009783} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
SLGNAYFGEGSGPIAMDDVQCTGNEHHLWECSHRGWFSHNCGHYEDAGVICSDSKISCGG
ILVNPSGSFTSPNYPENYPNLLNCIWEIKADIDFQISLVIDDLQLELEDVCIYDYIEVFD
GSLDGASFGRFCKGPIRTLTSSTHQMTVLFKTDGSITNRGFSASYSTSHKVLDWRVVEMM
NSSNRCEGRVEVYHSGLWGTICDDDWDLQDAQVVCRQLGCGAAISAPGNAYFGQGSGPIA
IDDVQCTGKEYNLIDCPHRGWFSHNCGHYEDASVICSKQQCNDPEQLRGITRKNAINNCG
GYLDAFGGSFTSPNYPKPHPEFAYCVWHIRVDKGYQINIDFKEIFLEIDDNCRFDFIAVY
DGPSTNSGLLGKVCGRITATFQSSSNIMTVVLSTDYANSYRGFSASYAPVYEKEVNSTSL
TCSSDQMTAIISKSFLESLHYNEDNLQLIDPLCRPRVSNVLEFPIPLNKCGTIKQVEDHT
ITYTNIISITNSTSSAVITRQKHLQIILKCEMENNSTVEIMYITEDDIIKNISALGKYNV
SMALYESESFNNPLLNSPYYVELNQTLFVQVSLHVLDPNLVVFLDTCTASPTSDFASPTY
DLIRSGCSKDDTCKIYPPSGHYGRFQFSAFKFLRSLGSVYLQCKVWICESNDTQSRCNQG
CISRRKRDISSYKWKTESIIGPIRLKTDHTESSNLG
Download sequence
Identical sequences F7EBB8
ENSMODP00000009783 13616.ENSMODP00000009783 ENSMODP00000009783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]