SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ECN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ECN1
Domain Number 1 Region: 5-207
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.6e-50
Family D-ribulose-5-phosphate 3-epimerase 0.00000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7ECN1
Sequence length 230
Comment (tr|F7ECN1|F7ECN1_CALJA) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=RPE OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAIAGANQYTFHLEATENPGALIKDIRENGMKSCSFAQ
AKVQWPSQGPLQVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHW
LRTQFPSLDIEVDGGVGPDTVHKCAECSGQIPLWLYLCHTFLLDIYLSKT
Download sequence
Identical sequences F7ECN1
ENSCJAP00000044608 ENSCJAP00000044608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]