SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ECS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ECS6
Domain Number 1 Region: 272-330
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000537
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7ECS6
Sequence length 375
Comment (tr|F7ECS6|F7ECS6_CALJA) Transcription factor like 5 {ECO:0000313|Ensembl:ENSCJAP00000018339} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TCFL5 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
DFQELRMMLLSEAGARKTPGGGDGARARADGAAKEGASAGAVGPEAASEARAKPAVRVRL
EDRFNSIPAEPPPAPRGPEPPEPGVALNNLVTLIRHPSDLMTVPLHQQQNKCTTSVKNKP
AASATALQFTCPLFTANACSASGNSNLSQTQSSSNSCSVLEAAKHQDVGLPRAFSFCYQQ
EMESTKQTLGSRNKALPEQVWIKVGEEALCKQALNKRNRSRMRQLDTNVERRALGEIQNV
GEGTAAMQGTWQSSESSQSNLGEQAQSGPQGGRSQRRERHNRMERDRRRRIRICCDELNL
LVPFCNAETDKATTLQWTTAFLKYIQERHGDSLKKEFESVFCGKTGRRLKLTRPDSLVTC
PAQDSLQSSPPMEIK
Download sequence
Identical sequences F7ECS6
ENSCJAP00000018339 ENSCJAP00000018339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]