SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ECU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ECU1
Domain Number 1 Region: 317-598
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.68e-71
Family Tandem AAA-ATPase domain 0.0000658
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7ECU1
Sequence length 648
Comment (tr|F7ECU1|F7ECU1_CALJA) DEAD-box helicase 43 {ECO:0000313|Ensembl:ENSCJAP00000018337} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=DDX43 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSQHGEAPKASTWVVAGRRSSTASRAPERRLAEELNRGGSEGYRVVRGGCWRGASRPPNA
VAAGHREPPLCFALKNHFVGAVIGRGGSKIKHIQNTTNTIIQIIQERPESFVKIYGSRAM
QGKAKAVIDNFVKKLEENSECRVVEKTNLIKMFLTGVALQPSVVAGARPLIDWDQIREEG
LKWQQKKWADLPPIKKNFYKESAATSAMSKVQADSWRKENFNITWDDLKDGEKRPIPNPT
CTFDDAFHYYPEVMENIKKSGFKKPTPIQAQAWPIVLQGIDLIGVAQTGTGKTLCYLMPG
FIHLDLQPTFKGQRNRPGMLVLTPTRELALQVEGECCKYSYKGLRSVCVYGGGNRDEQIE
ELRKGVDIIIATPGRLNDFQMNNFVNLKNITYLVLDEADRMLDMGFEPQIMKILLDVRPD
RQTVMTSATWPRSVHRLAQSYLKEPMLVYVGTLDLVAVSSVKQNIIITTEEEKWIHIQTF
LQSLSTTDKVIVFVSRKAVADHLSSELILGNMSIESLHGDREQRDREKALENFKTGKVRI
LIATDLASRGLDVHDITHVYNFDFPRNIEEYVHRIGRTGRAGRTGVSITTMTRNDWRFAP
ELVNILQRANQIIPDDLLSMAERFKARQQKREMERKMEKPQGRPKKFH
Download sequence
Identical sequences F7ECU1
ENSCJAP00000018337 ENSCJAP00000018337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]