SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EDJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EDJ0
Domain Number 1 Region: 558-646
Classification Level Classification E-value
Superfamily PH domain-like 6.27e-21
Family Third domain of FERM 0.0044
Further Details:      
 
Domain Number 2 Region: 373-465
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-17
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 270-316,501-557
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000014
Family Second domain of FERM 0.0042
Further Details:      
 
Weak hits

Sequence:  F7EDJ0
Domain Number - Region: 29-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00547
Family Ubiquitin-related 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7EDJ0
Sequence length 669
Comment (tr|F7EDJ0|F7EDJ0_MONDO) Fermitin family member 1 {ECO:0000313|Ensembl:ENSMODP00000028514} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=FERMT1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MAKMFSSSDFGTTSWELIIRLDHQNEKEQKVFTLRVSGDLHIGGVMLKLVEQINIAQDWS
DYALWWEQKHCWLLKTHWTLDKYGVQADARLLFTPQHKMLRLRLPNMKTVRLKVSFSSVV
FKAVGDICKTLNIRRSEELSLLKPSDDYFKKKKKKEKNNREPLIEDILNLDNSITSSGSP
VLLSLSPMLHFVDSPLTGQNCNILAFSQPSCSPETLAEMFQPRSLIDKAKLNAGWLDSSR
SLMEQGIQEDEKLLLRFKYYTFFDLNPKYDAIRINQLYEQARWSILLEEIDCTEEEMLIF
AALQARINKLSLSAETLDFTNESEVDEVEAALSNLEVTLEGGKTDNILEDITDIPKLADY
LRLFRYYSFIFRAKKLTLKTFKLYWFVFKDTSIAYFKNKDLEQGEPVERLHLRGCEVVPD
VNVSGRKFGIKLLIPVADGMNEVYLRCDNENQYARWMAACILASKGKTMADSSYWPEVNN
ILSFLKMKNRNTSSQAPSDPECMDMKPECFVSPRCAKKHKPKQLAARILEAHQNVAQMSL
VEAKLRFIQAWQSLPEFGLTYYIVRFKGSKKDDLLGVSYNRLIRIDMATGDPITTWRFAN
MKQWNVNWEIRKVTIEFDQNVSIAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLDEDL
FHKLTGGQE
Download sequence
Identical sequences F7EDJ0
ENSMODP00000028514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]