SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7EEN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7EEN2
Domain Number - Region: 3-52,283-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0255
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7EEN2
Sequence length 431
Comment (tr|F7EEN2|F7EEN2_CALJA) Protein FAM69B {ECO:0000313|EMBL:JAB01881.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=FAM69B OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MRRLRRLAHLVLFCPFSKGLQGRLPGLRVRCIFLAWLGVFAGSWLVYMRYSSYSELCRGH
ICQAVICDQYHKGIISGSICQDLCELHLVEWRTCLSAAPGQQVYSGLWRDKDVTIKCGIE
EALDSKAQSDAAPRRELVLFDKPTRGTSIKEFREMTLSFLKAKLGDLPSLPALVGQVLLM
ADFNKDNRVSLAEAKSVWALLQRNEFLLLLSLQEKEHASRLLGYCGDLYLTEGVPHGAWH
VAALPPLLRPLLPPALQGALQQWLGPAWPWRAKIAIGLLEFVEELFHGAYGTFYMCETTL
ANVGYTATYDFKMADLQQVAPEATVRRFLQGRRCEHSTDCTYGHDCRAPCDRLMRQCKGD
LIQPNLAKVCALLRGYLLPGAPADLREELGTQLRTCTTLSGLASQVEAHHSLVLSHLKTL
LWKKISNTKYS
Download sequence
Identical sequences F7EEN2
ENSCJAP00000020253 XP_002743512.1.60252 ENSCJAP00000020253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]