SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EFA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EFA8
Domain Number 1 Region: 944-1035
Classification Level Classification E-value
Superfamily Immunoglobulin 5.52e-26
Family I set domains 0.0058
Further Details:      
 
Domain Number 2 Region: 372-462
Classification Level Classification E-value
Superfamily Immunoglobulin 2.91e-23
Family I set domains 0.0000229
Further Details:      
 
Domain Number 3 Region: 664-756
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-22
Family I set domains 0.007
Further Details:      
 
Domain Number 4 Region: 184-275
Classification Level Classification E-value
Superfamily Immunoglobulin 9.04e-20
Family I set domains 0.0058
Further Details:      
 
Domain Number 5 Region: 1139-1232
Classification Level Classification E-value
Superfamily Immunoglobulin 3.22e-19
Family I set domains 0.019
Further Details:      
 
Domain Number 6 Region: 524-616
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000168
Family I set domains 0.048
Further Details:      
 
Domain Number 7 Region: 858-933
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000511
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7EFA8
Sequence length 1234
Comment (tr|F7EFA8|F7EFA8_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000035342} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
QRQRIMAEKEDEELLRPVTTTQRLSEYKSELDHMAKMAKEEKSRKKTRREREITEITEIE
EEIEISKRAQRESSSSVSRLLGRRRSLSPTYIELMRPVSELIRPRTQPAEEYETERRSPT
PERTRPRSPSPVSSERSLSRFERTARFDIFSRYESMKAALKTQKSSERKYEILSQQPFTL
DHAPRITLRMRSHRVPCGQNTRFILNVQSKPTADIKWYHNGVELQESSKIHYTNTSGVLT
LEILDCHIDDSGTYRAVCTNYKGEASDYATLDVTGGAYTTYTSQRKDEEVPRSIFPELTR
TEAYAVSSFKKTSEMEASSSVREVKSQMTETRETLTSQERYASTEMKATASEERSVEEKA
THRKIKTTLAARILTKPRSITVYEGESARFSCDTDGEPVPTVTWLRAGQVISSSGRHQVT
TTKYHSTFEISSVQASDEGSYTVVVENSEGKQEAQFTLTLQKTRVPEKSVTSPPRVKSPE
PHAKSAEAVKSPKRVKSPELVPSHPKTTSPTETKAARTEKEQLPIAAPPKIVQPLKVEAS
KDIAKLTCAVQSSVLSAKEVAWYKDGKKLKENGHFQFHYSADGTYELKIHNLTEADRGEY
VCEISGEGGASKTNFQFVGQAFTSIPVEKTAESTDIKKSAQKATEPTETKKTEKKDAGPA
TSKPVIVTGLQDMTITANTVAKFSIKATGEPWPTVSWTKDGKALVQDGKYELSEDKGGFY
LEIRETSASDSGLFTCTVINSAGSVSSSCKLTIKDTKEEEKKIMTQKTSEIASQKKAVAQ
EVTKMAMVSEEIQKSETVSHEKSSVKEEFSKALISEEIKKSEAASLGKSVVHEEIVKKTQ
ASEEIRAHAEIKASSTQMSISEGQKITLKANIADASEVRWVLNGVELTNSEDYRYGVSGN
DHTLTIKKASHRDEGILTCVGKTSQGIIKCQFDMMLCQERLDAPVFITQPKSQNVNEGQN
VLFSCEINGDPSPEIEWFKNNLPISVSSNVRVSRSKNAYSLEIRNAAVTDSGKYTIKAKN
FHGQCSATASLTVLPLVEEPSKEVVLRTSDDTSMQGIFSSQSVQMSASKQEASFSSFSTS
STSSMSEMKFASMSAQSMSSMQESFVEMSSRSSMGKSSMTQLESSTSRMLKAGIRGIPPK
IEALPSDISIDEGKVLTLACAFTGEPIPEITWSYGGRKIQNQEQQGRFHIETTDDLTTLI
IMDVQKKDGGLYTLSLGNEFGSDSATVNINIRSI
Download sequence
Identical sequences F7EFA8
13616.ENSMODP00000035342 ENSMODP00000035342 ENSMODP00000035342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]