SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EIU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EIU7
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.65e-42
Family Decarboxylase 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7EIU7
Sequence length 252
Comment (tr|F7EIU7|F7EIU7_CALJA) Orotidine 5'-phosphate decarboxylase {ECO:0000256|RuleBase:RU000512} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=UMPS OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MLEILEQQKKIDTEMAGRVKRFIKENVFVAANQNGSPFSVKETPKELSFGARAELPRIHP
VASKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMKEL
ITLAKRYEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVG
LPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPG
VQLEARGDNLGQ
Download sequence
Identical sequences F7EIU7
ENSCJAP00000012135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]