SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ELT8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ELT8
Domain Number 1 Region: 355-546
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.19e-50
Family cAMP-binding domain 0.0000000291
Further Details:      
 
Domain Number 2 Region: 88-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.16e-36
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7ELT8
Sequence length 775
Comment (tr|F7ELT8|F7ELT8_CALJA) Hyperpolarization activated cyclic nucleotide gated potassium channel 3 {ECO:0000313|Ensembl:ENSCJAP00000015531} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=HCN3 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEAEQGPAAAGASEGATPGLEAVPPAAPPPATATSGPIPGSGPEPKRRHLGTLLQPTVNK
FSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFK
EENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPEAIRTRYLRTWFLVDLIS
SIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFH
MTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYS
HALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQ
YQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFEEESILGELSEPLREEIINFTC
RGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARG
AQDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETV
AMDRLRRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGLAPSTGARLSGK
PVLWEPLVHVPLQAAAVTSNVAIALTHQRGPLPLSPDSPAILLARSARRSAGSPASPLVP
VRAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSL
PQRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPGGPQLSANM
Download sequence
Identical sequences F7ELT8
ENSCJAP00000015531 ENSCJAP00000015533 XP_002760136.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]