SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EMH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EMH5
Domain Number 1 Region: 534-561,605-687
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000137
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7EMH5
Sequence length 701
Comment (tr|F7EMH5|F7EMH5_CALJA) Solute carrier family 26 member 1 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=SLC26A1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGESPELLQQGRGLVPVRRQRPAPQGLREMLKARLLRSCSCSVPCAWALVQDLLPATRWL
CQYRPREYLAGDIMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLMGTSRH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSQDGLWPRANSSILNGSAATPDCGRDCYAIRV
ATALTLMTGLYQVLMGVLRLGFVSAYLSQPLLDGFAMGASVTILTSQLKHLLGVRIPRHQ
GLGMVVRTWLSLLLSAGQANVCDVVTSAVCLAVLLAAKELSDRYRRHLRVPLPTELLVIV
VATLVSHFGQLHKHFGSSVAGDIPTGFMAPQVPEPRLMQRVALDAVALALVGAAFSISLA
EMFGRSHGYSVRANQELLAVGCCNVLPAFLHCFATSAALAKSLVKTATGCRTQLSSVVSS
AVVLLVLLALAPLFHDLQRSVLACVIVVSLRGALRKVWDLPRLWRMSPADALVWAGTAAT
CVLVSTETGLLAGIILSLLSLAGRTQRPHAALLARIGDSAFYEDATEFEGLVPEPGVRVF
RFAGPLYYANKDFFLRSLYSLTGLDAGRMAARRKEQGSEVGVGEGGPAQGKDLGPVSSRA
ALVPVAAGFHTVVIDCAPLLFLDAAGVTTLRDLRRDYGALGISLLLACCSPPVRDILSRG
GFLGEGLEDTAEEEQLFLSVHDAVQTAGARHRELEATDACL
Download sequence
Identical sequences F7EMH5
ENSCJAP00000003332 ENSCJAP00000003332 ENSCJAP00000003339 XP_008991979.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]