SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7END5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7END5
Domain Number 1 Region: 1109-1287
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.55e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 671-786
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.94e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 439-558
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-24
Family Pleckstrin-homology domain (PH domain) 0.0000113
Further Details:      
 
Domain Number 4 Region: 863-1024
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-24
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 5 Region: 1421-1559
Classification Level Classification E-value
Superfamily PH domain-like 6.68e-19
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 6 Region: 6-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.82e-17
Family SAM (sterile alpha motif) domain 0.0000365
Further Details:      
 
Domain Number 7 Region: 572-686
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000257
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 8 Region: 1002-1101
Classification Level Classification E-value
Superfamily PH domain-like 0.000000113
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7END5
Sequence length 1694
Comment (tr|F7END5|F7END5_CALJA) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSCJAP00000039063} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ARAP2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSSVNEVNVDIKDFLMSINLEQYLLRFHESGFTTVKDCAAINDSLLQKIGISPTGHRRRI
LKQLQILLLKMQDIPIYANVHKTKKNDDPSKDHHVLSSDQNICIELSDSSSVQTPSPPQL
ETVTKNVEENDANVERSQYPPSDDKLSLPKHDFPASEEPHLNLGSLNDYLFGSKNIKIES
LITKQTVDHTSEVRKSAVRSIMQTLEPHLSGESTSDTHGYRPNSFLVGSSPYPFCQFQGE
LMYVPSSPILAHMRSGSKYVSRPSRSSKIRHRPVPEISGSSKGIFGSYFRERRNVATSTE
KSAAWQNSNEENSSSIFPYGETFLFQRLENSKKRSIKNEFWIQKERLKGEATTATNSFII
KSSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTPSESEYSTVEECFQSLRRKNSKASKS
RTQKALTLDSVNRHSYPLSSTSGNADSSAISSQSISPYACFYGTSAKKVKSGWLDKLSPQ
GKRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDNKFEVVTTQRTFVFR
VEKEEERNDWISILLNALKSQSLTSQSQAVVTPEKCGYLELRGYKAKIFTVLSGNSVWLC
KNEQDFKSGLGITIIPMNVANVKQVDRTAKQSFEIITPYRSFSFTAETEKEKQDWIEAVQ
QSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDS
KVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKNFITQKYK
EGKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAK
KAGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLYQAASAASKLSSEKKL
LEDTNKKWCVLEGGFLSYYENDKSTTPNGTISINEVICLAIHKEDFYLNTGPIFIFEIYL
PSERVFLFGAETCQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQLFYKDCHALDQWRKG
WFAMDKSSLHFCLQMQEAQEDRMHLRRLQELTISTMVQNGEKLDVLLLVEKGRTLYIHGH
TKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYDKGLGCKYIYQKN
GDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWISAL
DTQDDKERIKKYGAFIRTLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSCLF
QTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVY
VERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIENEELERPLHYKE
NVLEQVLRWSSLAEPGSAYLVVKRFLTADTIKHCSDRSALGSIKEGLLKIKEEPSKILSG
NKFQDRYFVLRDGFLFLYKDAKSSKHEKMFSLSSVKFYRGVKKKMKPPTRRCSWGLTAHS
EKHHWHLCCDSSQTQMEWMTSIFVAQHENDIWPPAGKERKRSITKNPKIGGLPLIPIQHE
TNATLARRNIESARAELERLRLSEKRDKEAVDSSLKERASIVAHCLEHKDDKLRSRTRKH
RSFNCLEDTEPEAPLGQQKGHKGLKTLRKADDRNSKATLDSDHKLPSRVIEELSVVLQRS
RTLPKELQDEQILP
Download sequence
Identical sequences F7END5
ENSCJAP00000039041 ENSCJAP00000039063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]