SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ENI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ENI0
Domain Number 1 Region: 875-1055
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.49e-46
Family Ypt/Rab-GAP domain of gyp1p 0.0033
Further Details:      
 
Domain Number 2 Region: 1030-1151
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.18e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 3 Region: 159-192,249-397
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-29
Family Phosphotyrosine-binding domain (PTB) 0.0053
Further Details:      
 
Domain Number 4 Region: 14-157
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-17
Family Phosphotyrosine-binding domain (PTB) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7ENI0
Sequence length 1228
Comment (tr|F7ENI0|F7ENI0_MONDO) TBC1 domain family member 1 {ECO:0000313|Ensembl:ENSMODP00000025684} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=TBC1D1 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEPITFTAKKHAFPSEISVDFSLQLVGSLPVHYLTTMPMLPWVVAEVRRLSTQSSKKEHV
VNQIRLCVSPACLKCEPDPGKSHQWDPLICSSIFEYKPQQVHKLIHNSHDPSYFACLIKE
DTASQQSICYVFKADDQTKVPEIISSIRQAGKIARQEEFHSQSEFDDTFAKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSCSRKAELDMLAQNSEAISTVGGFSLTDKFRSVFQPG
GSAEQDRKPMRKSFSQPGLRSLAFKKEFQDAGYRSSSFFGGSFEENDIQSHLISGHNIVQ
PTDIEENRTMLFTIGQSEVYLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSE
NGGFHFVCYVFQCTNEALVDEIMMTLKQAFTVAAVQQQTSRVPVQQCEGCPMHYLHKLCE
RIEGMSSSKTKLELQKHLTTLNNQEQATIFEEVQKIRPRNEQKENELIISFLRCLYEEKQ
KDHVHIGESKQTSQISAETIRNELPTNAPRFRLDMLKSKAKRSLTESLESILSRGSKGKG
LPEQSGSVDLDSSVSSTFSNTSKELSMGEKELPALPEGSCPPPGSLDDLSSTSGSPLPEE
AAPPSPRQEFRRRANTLSHYPVEGQKPPEPPEASPGLPQRKLMSLNPPVDESKSRSGQSS
TPALPPHRLNPSASSPNFFKYLKHNSSGEQGGNAVSKSISYRSALRKKLHSSSSVPNFLK
FLAPVDENNTSDFRSTKRDFESKTHHHDSNNESPLKTRRHSWRQQIFLRVATPQKGCDSP
SRFEDYSDLGDLPPRSPLEPVCEDGPFGPVIEEKKRTSRELRELWKKAILQQILLLRMEK
ENQKLQASENDLLNKRLKLDYEEITPCLKDVTSVWEKMLSTPGRSKIKFDMEKMHSAVGQ
GVPRHHRGEIWKFLAEQYHLKHPFPNKQQPKDTPYKELLKQLTSHQHAILIDLGRTFPTH
PYFSAQLGAGQLSLYNILKAYSLLDPEVGYCQGLSFVAGVLLLHMSEEDAFKMLKFLMFD
MGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYSHLEEHEIGPSLYAAPWFLTMFASQFP
LGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIKNTLPNLGLVQME
KTINQVFEMDISKQLQAYEVEYHVLQDELIDSSPLSDNQRMDKLEKTNSSLRKQNLDLLE
ELQRKTPRFKYYCYFMADLELEPYSLDS
Download sequence
Identical sequences F7ENI0
ENSMODP00000025684 ENSMODP00000025684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]