SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ENN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ENN2
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 629-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000541
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 731-863
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000102
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000383
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 5 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000061
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 6 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000693
Family EGF-type module 0.007
Further Details:      
 
Domain Number 7 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000166
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 708-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  F7ENN2
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00028
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00873
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7ENN2
Sequence length 1218
Comment (tr|F7ENN2|F7ENN2_XENTR) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=jag1 OC=Silurana.
Sequence
MRFPRRALFFSALSFRLIIALLCLRLKVSIASGQFELEILSMQNPNGELQSGNCCDGQRN
PTDRKCSRDECDTYFKVCLKEYQSRVSAGGACSFGTGYTPVIGGNSFNLKYSRNNERNRI
VLPFSFAWPRSYTLVVEAWDYNNDTNDPGDLIDKALHSGMINPSRQWQTLKQNAGMTHFE
YQIRVICDEHYYGFGCNKFCRPRDDFFGHYTCDQNGNKTCLEGWMGPECNKAICRQGCSS
KHGTCKTPGECRCQYGWQGQYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTYQPCLNGGTCSNTGPDKYQCSCPEGYSGLNCEIAEHACLSDPCHNGGSCLETSVGFEC
QCARGWTGPTCSINIDECSPNPCGYGGTCQDLVDGFKCICPSQWTGKTCQIDANECEAKP
CVNANSCRNLIGSYYCNCLPGWTGQNCDININDCLGQCQNGGTCRDLVNGFRCICPPGYA
GERCEKDVNECVSNPCLNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPDPCQNGAQC
FNLATDYFCNCSEDYEGKNCSHLKDHCRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCG
PHGKCRSQSGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GIYCETNINDCSKNPCYNGGTCRDLVNDFYCECKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDTFKCICPAGWEGATCNIARNSSCLPNPCFNGGTCVVRGDSFTCVCKEGWEGPTCS
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCIDEIN
GYRCTCPPGRSGPRCQEVTGRPCITNGHMMPDGAKWDDDCNSCQCLNGKVTCSKVWCGPQ
RCDIHGSSECPAGQTCVPIRDNHCFVPPCTGVGECWPTNQPPVKTKCNANASYQDASCAN
ITFTFNKEMMSPGLTTESICNELRNLNILKNVSAEYSIYITCELSPSANNEIHVAISVEE
NGDGRNPVKDITERIIDLVSKRDANNTFIASVAEVRVQRRQAKNGTDFLVPLLSSILTVA
WVCCLVTAFYWCIRKRRKQSSHSHTASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKIAKIRTHNSEVEEDDMDKHQQKPRYVKQPAYTLVDRDEKPPNSTPSKQPNWTNKQ
DNRDLETAQSLNRMEYIV
Download sequence
Identical sequences F7ENN2
gi|301604268|gb|XP_002931784| 8364.ENSXETP00000004994 XP_002931784.1.99540 ENSXETP00000004994 ENSXETP00000004994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]