SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EPG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EPG7
Domain Number 1 Region: 167-364
Classification Level Classification E-value
Superfamily E set domains 8.4e-74
Family Cytoplasmic domain of inward rectifier potassium channel 0.00000478
Further Details:      
 
Domain Number 2 Region: 61-183
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.08e-20
Family Voltage-gated potassium channels 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7EPG7
Sequence length 391
Comment (tr|F7EPG7|F7EPG7_MACMU) Potassium voltage-gated channel subfamily J member 1 {ECO:0000313|Ensembl:ENSMMUP00000004204} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_07084 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MNASRWNVFETLIRVLTESMFKRLRKWVVTRFFGPSRQRARLVSKDGRCNIEFGNVEAQS
RFIFFVDIWTTVLDLKWRYKMTIFITAFLGSWFFFGLLWYAVAYIHKDLPEFHPSPNHTP
CVENINGLTSAFLFSLETQVTIGYGFRCVTEQCATAIFLLIFQSILGVVVNSFMCGAILA
KISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGE
TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLIQQDFELVVFLDGT
VESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLY
NEKDARARMKRGYDNPNFILSEVNETDDTKM
Download sequence
Identical sequences F7EPG7
ENSMMUP00000004204 9544.ENSMMUP00000004204 ENSMMUP00000004204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]