SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7ERR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ERR3
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000959
Family Complement control module/SCR domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7ERR3
Sequence length 107
Comment (tr|F7ERR3|F7ERR3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000020457} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
CSQASPPQGGTFQVIASSGTTLGTIMMFHCPIGHQMQGQCIVTCIWRENGTECTNGTLTC
KALPIYETFGFKVAVIASIISCAIIPLMSVAFLTCCLFKCVKKNEWR
Download sequence
Identical sequences F7ERR3
ENSMODP00000020457 ENSMODP00000020457 13616.ENSMODP00000020457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]