SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7EUD2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7EUD2
Domain Number 1 Region: 1027-1206
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 2 Region: 1213-1333
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-34
Family Pleckstrin-homology domain (PH domain) 0.00000222
Further Details:      
 
Domain Number 3 Region: 265-401
Classification Level Classification E-value
Superfamily Spectrin repeat 1.02e-18
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 4 Region: 845-982
Classification Level Classification E-value
Superfamily Spectrin repeat 7.07e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 5 Region: 588-747
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000161
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 6 Region: 22-168
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000785
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 7 Region: 178-296
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000759
Family Spectrin repeat 0.0084
Further Details:      
 
Weak hits

Sequence:  F7EUD2
Domain Number - Region: 407-460
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0552
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7EUD2
Sequence length 1410
Comment (tr|F7EUD2|F7EUD2_CALJA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCJAP00000011992} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KALRN OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
CGILRLNDKGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQED
LRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVALIIKPDN
FWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEF
FNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLL
QCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLR
LFEQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMNSMNAYVNINRIMS
VASRLSEAGHYATQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDA
WCKMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSES
LTATANYSKAVHQVLDVVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLR
QMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASGIELICEKD
IDLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLN
ASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQQKAEVLLQAGHYDA
DAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCG
GRDKLGPAAEIDHVIPLISKHLEQKEAFLKTSCTLARRNAEVFLKYIHRNNVSMPSVASH
TRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEFY
LSTHTSAGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWV
TTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREVKLRDANHEVNE
EKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNI
QEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTF
FDEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKA
NDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKD
STGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQEWIK
NIREVIQERIIHLKGALKEPLQLPKTPAKQRNNSKRDGVEDIDSQGDGSSQPDTISIASR
TSQNTVDSDKDGNLVPRWHLGPGDPFSTYV
Download sequence
Identical sequences F7EUD2
ENSCJAP00000011992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]