SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7F1K2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7F1K2
Domain Number 1 Region: 41-115
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000373
Family Rhamnogalacturonase B, RhgB, middle domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7F1K2
Sequence length 241
Comment (tr|F7F1K2|F7F1K2_CALJA) ER membrane protein complex subunit 7 {ECO:0000313|Ensembl:ENSCJAP00000039275} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=EMC7 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAAALWGFFPVLLLLLSGDVQSSEMPGAAAEGSVGSGVGIGDRFKIEGRAVVPGVKPQDW
ISAARVLVDGEEHVGFLKTDGSFVVHDIPSGSYVVEVVSPAYRFDPVRVDITSKGKMRAR
YVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTDFLMNPMVMMMVLPLLIFVLLPK
VVNTSDPDMRREMEQSMNMLNSNHELPDVSEFMTRLFSSKSSGKSSSGSSKSGKSGAGKR
R
Download sequence
Identical sequences F7F1K2
XP_002807249.2.60252 ENSCJAP00000039275 ENSCJAP00000039275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]