SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7F262 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7F262
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily PH domain-like 5.51e-29
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 148-200
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.44e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7F262
Sequence length 238
Comment (tr|F7F262|F7F262_MONDO) Pleckstrin homology and FYVE domain containing 2 {ECO:0000313|Ensembl:ENSMODP00000034552} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PLEKHF2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPNDFLAIFPWPKYKWSGHFRALSTSHRLGICSTLSYWLQ
Download sequence
Identical sequences F7F262
ENSMODP00000034552 ENSMODP00000034552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]