SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7F3I2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7F3I2
Domain Number 1 Region: 157-247
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7F3I2
Sequence length 252
Comment (tr|F7F3I2|F7F3I2_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000035316} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MESEMEAQSAGAEEGFTQVTGKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVF
PPLCGDGLLSGKEGTRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRT
CKETKDVSALTKAADFVKAFILGFQVEDALALIRLDDLFLESLEITDVKPLKGDHLSRAI
GRIAGKGGKTKFTIENVTRTRIVLADVKVHILGSFQNIKMARTAICNLILGNLPSKVYGN
IRAVASRSADGF
Download sequence
Identical sequences A0A2K5UGI2 F7F3I2
ENSMMUP00000035316 ENSMMUP00000035316 9544.ENSMMUP00000035316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]