SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7F6W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7F6W4
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.75e-75
Family Inorganic pyrophosphatase 0.00000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7F6W4
Sequence length 178
Comment (tr|F7F6W4|F7F6W4_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000035831} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=PPA1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNVRNSVVIL
Download sequence
Identical sequences A0A2I3LQV1 A0A2K5VDU0 A0A2K6AAT4 A0A2K6D613 A0A2K6M153 A0A2K6R6E5 F7F6W4
ENSMMUP00000035831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]