SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7F7V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7F7V7
Domain Number 1 Region: 61-170
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-25
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 2 Region: 256-362
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 3.28e-20
Family Platelet-derived growth factor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7F7V7
Sequence length 370
Comment (tr|F7F7V7|F7F7V7_MONDO) Platelet derived growth factor D {ECO:0000313|Ensembl:ENSMODP00000001127} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=PDGFD OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MYRLILLYTIVCANFCSYWDTLAIPQSGSIKALRSSNLRRDAGNHLTDLYRKEEIIQVMG
NGIIHSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEPENDICRYDFVEVEDIS
ETSTVIRGRWCGQKEVPPRIRSRTNQIKITFKSDDYFVAKPGFKIYYSLVDDFQPPAASE
TNWESVTSSLSGVSYHSPSVTDPTLTADALDQTVAGFDTVEDLLKHFNPETWQEDLENLY
MDTPQYRGRSYYDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELRLTNVVFFPRCLLVQ
RCGGNCGCGSNNWKSCTCTSGKTVKKYHEVLKFEPGHFKRKGKTKNMALIDIQLDHHERC
DCICSSRPPR
Download sequence
Identical sequences F7F7V7
13616.ENSMODP00000001127 ENSMODP00000001127 ENSMODP00000001127 XP_001362974.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]