SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7F841 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7F841
Domain Number 1 Region: 1108-1284
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00059
Further Details:      
 
Domain Number 2 Region: 670-785
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.94e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 862-1023
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-24
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 435-557
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-24
Family Pleckstrin-homology domain (PH domain) 0.0000113
Further Details:      
 
Domain Number 5 Region: 1418-1555
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-19
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.72e-17
Family SAM (sterile alpha motif) domain 0.0000313
Further Details:      
 
Domain Number 7 Region: 571-669
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000308
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 8 Region: 1000-1094
Classification Level Classification E-value
Superfamily PH domain-like 0.000000222
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7F841
Sequence length 1688
Comment (tr|F7F841|F7F841_MACMU) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSMMUP00000009032} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ARAP2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLHFHESGFTTVKDCAVINDSLLQKIGISPTGHRRRI
LKQLQIILSKMQDFPIYANVHKTKKNDDPSKDHNVPSSDQNICIELSSSSSVQMPSPPQL
ETVTKKLEDDASVERSQYPQTDNKLSPPKRDFPTSEEPHLNLGSLNNSLFGSENIKIESL
ITKKTVDHTIEEQQTEKVKLISENLNKLPNADSECLSSVGCSTSEMNSRNGTNGLLDGSP
PSPFFKFQGEMIVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISG
SYFRERRNVATSTEKSVAWQSESMSKQYVFFKRSIKNEFLTQEEALKGEATTATNSFIIK
SSIYDNRKEKISEDKVEDIWIPREDKNNFLIDTASESEYSTVEECFQSLRRKNSKASKSR
TQKALTLDSVNRHSYPLSSTSGNADSSAVSSQAISPYACFYGASVKKVKSGWLDKLSPQG
KRMFQKRWVKFDGLSISYYNNEKEMYSKGIIPLSAISTVRVQGDNKFEVVTTQRTFVFRV
EKEEERNDWISILLNALKSQSLTSQSQGIVTPEKCGYLELRGYKAKIFTVLSGNSVWLCK
NEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAETEKEKQDWIEAVQQ
SIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSLGPKDSK
VRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKNFITQKYKE
GKFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHSTPYLLAKK
AGQSLQMEFLYHNKFSDFPQHDIHSEGVLSQESSQSTFLCDFLYQAPAAASKLSSEKKLL
EETNKKWCVLEGGFLSYYESDKSTTPNGTININEVICLAIHKEDFYLNTGPIFIFEIYLP
SERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYDLIGQLFYKDCHALDQWRKGW
FAMDKSSLHFCLQMQEVQGDRMHLRRLQELTISTMVQNGEKLDVLLLVEKGRTLYIHGHT
KLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDP
LHISELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWISALDAQ
DDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSCLFQTE
GQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIEVYVER
KEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIENEELERPLHYKENVL
EQVLRWSSLAEPGSAYLVVKKFLTADTIKHCSDRSTLGSIKEGILKIKEEPSKILSGNKF
QDRYFVLRDGFLFLYKDVKSSKHDKMFSVSSVKFYRGVKKKMKPPTSWGLTAYSEKHHWH
LCCDSSRAQMEWMTSIFIAQHENDIWPPAGKERKRSITKNPKIGGLPLIPIQHEGNATLA
RKNIESARAELERLRLVEKCDRESMDSSLKERASMVAHCLEHKDDKLRNRTRKHRSFNCL
EDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPRE
LQDEQILK
Download sequence
Identical sequences F7F841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]