SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7F964 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7F964
Domain Number 1 Region: 42-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000721
Family V set domains (antibody variable domain-like) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7F964
Sequence length 235
Comment (tr|F7F964|F7F964_MONDO) T-cell surface glycoprotein CD8 alpha chain precursor {ECO:0000313|Ensembl:ENSMODP00000011883} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CD8A OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
VPRAVARALLPTSPALSFPEPLGAQEHVTFRMNPVEKRDAGQGRELKLQCETVNSSPTGC
SWLRLTPGAVVPTFLLYLSGSSQSVKVAPELDSRRFGGSRSSSSYFLTLKDFQKDDQGYY
YCVVARNSRLFFSPFVPVFMPVKATTAPAPRPKPTTPAATNSSIQNAAGSEKCKSFSNTS
VSLCFVYTEKNGLDFSCDLYIWMPLTGGCVVLLLALIITITIFRRSRRRVCQCPR
Download sequence
Identical sequences F7F964
13616.ENSMODP00000011883 ENSMODP00000011886 ENSMODP00000011883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]