SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FAH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FAH0
Domain Number 1 Region: 209-406
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.07e-61
Family Reprolysin-like 0.00000188
Further Details:      
 
Domain Number 2 Region: 425-500
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 7.07e-21
Family Blood coagulation inhibitor (disintegrin) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FAH0
Sequence length 918
Comment (tr|F7FAH0|F7FAH0_MACMU) ADAM metallopeptidase domain 19 {ECO:0000313|Ensembl:ENSMMUP00000028378} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=ADAM19 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MPGGAGAARLCLLALALQLLRPRAAREPGWTRGSGEGSPKLQHELIIPQWKTPESPVREK
HPLKAELRVMAEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTTLKLEDHCFYHGTVR
ETELSSVTLSTCRGIRGLITVSSNLSYVIEPLPDSEGQHLIYRSEHLKPPPGNCGFRHSK
LSTRDWALQFTQQTKKRPRRMKREDLNSMKYVELYLVADYAEFQKNRRDQDATKHKLIEI
ANYVDKFYRSLNIRIALVGLEVWTHGNMCEVSENPYSTLWSFLSWRRKLLAQKYHDNAQL
ITGMSFHGTTIGLAPLMAMCSVYQSGGVNMDHSENAIGVAATMAHEMGHNFGMTHDSADC
CSASAADGGCIMAAATGHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYGGRRCG
NGYLEDGEECDCGEEEECNNPCCNASNCTLRPGAECAHGSCCHQCKLLAPGTLCREQARQ
CDLPEFCTGKSPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQEQCQQLWGPGARPAPDLC
FEKVNVAGDTFGNCGKDMNGEHRKCNTRDAKCGKIQCQSSEARPLESNAVPIDTTIIMNG
RQIQCRGTHVYRGPEEEGDMLDPGLVMTGTKCGYNHICFEGQCRNTSFFETEGCGKKCNG
HGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPESVGPVVAGVLVAIFVLAVLMLM
YYCCRQNNKLGQLKPSALPSKLRQQFCCPFRVSQSSGTGHANPTFKLQTPQGKRKVINTP
EILRKPSQPPPRPPPDYLRGGSPPAPLPAHLSRAARNSPGPGSQIERTESSRRPPPSRPI
PPAPNCILSQDFSRPRPPQKALPANPVPGRRSLPRPGGASPLRTPGAGPQHSRPLAAPAP
KFPEYRSQRAGGMISSKI
Download sequence
Identical sequences F7FAH0
9544.ENSMMUP00000028378 XP_001105246.2.72884 ENSMMUP00000028378 ENSMMUP00000033795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]