SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FBJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7FBJ1
Domain Number - Region: 68-187
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000502
Family Canonical RBD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FBJ1
Sequence length 284
Comment (tr|F7FBJ1|F7FBJ1_MONDO) N-myc and STAT interactor {ECO:0000313|Ensembl:ENSMODP00000004393} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=NMI OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
IDEMVQTNTNLKIEIKKAEMELQRPSSSYLVKKNIPTKEIKFISAESPKDDSQYSDISCS
FQVTTQLEYELKKGQALITFEDEEVAQNVIKRGKHLVTFGSEEMKLMAKPVPLKTGLSLQ
VHSKISKKKIDVAGIPNELPEEQMRDKLALSFSKSQNGGGEVEHVEYSVNTQRAVITFLK
NGVADNILKHKKYPLFTNTSCYQVDVSPHMKRNVKKLQVFSGISKRTVLLTGLRNIQDDE
ESIEEDIFIHFQKGSNGGGDVEVVKCALKKPQIAYFEADLDQGC
Download sequence
Identical sequences F7FBJ1
13616.ENSMODP00000004393 ENSMODP00000004393 ENSMODP00000004393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]