SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FBW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FBW6
Domain Number 1 Region: 9-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.24e-27
Family Nuclear receptor 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FBW6
Sequence length 147
Comment (tr|F7FBW6|F7FBW6_MACMU) Nuclear receptor subfamily 1 group I member 3 {ECO:0000313|Ensembl:ENSMMUP00000023830} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=NR1I3 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MASREDELRNCVVCGDQATGYHFNALTCEGCKGFFRRTVSKSIGPTCPFAGSCEVSKIQR
RHCPACRLQKCLDAGMRKDILCPLKTRSPFSREQLWKSVISYSIPLSVSKHKTSSAGLFA
TQLKTQPVTDLELPRDMRLISCKRRWH
Download sequence
Identical sequences A0A2K5N4M3 A0A2K5VPQ3 A0A2K5XWS1 A0A2K6BPU7 F7FBW6
ENSMMUP00000023830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]