SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FG46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FG46
Domain Number 1 Region: 35-159
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.17e-18
Family Thioltransferase 0.000000539
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FG46
Sequence length 172
Comment (tr|F7FG46|F7FG46_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH25286.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_09080 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVI
IHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDP
SGKVHPEIINENGNPSYKYFYISAEQVVQGMKEAQERLTGDAFRRKHLEDEL
Download sequence
Identical sequences F7FG46
9544.ENSMMUP00000004381 ENSMMUP00000004381 ENSMMUP00000004381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]