SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FI18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FI18
Domain Number 1 Region: 81-153
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FI18
Sequence length 384
Comment (tr|F7FI18|F7FI18_CALJA) Mesoderm posterior bHLH transcription factor 2 {ECO:0000313|Ensembl:ENSCJAP00000044589} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MESP2 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAQTPPPQSLLSRDHWIFAQGWGWGHSDSHSTSPASSSDSSGSCPCDGARGLPQPAVLDR
GSQAAEAAPTTPRRARSGPAGGQRQSASEREKLRMRTLARALQELRRFLPPSVVPAGQSL
TKIETLRLAIRYIGHLSAVLGLSEESLQRRRLQRGEAGSSRGCPLCPDGGPAQAQTQTQR
EGLELGLGLGQGQGQGRGRVVRSWASWGSSPACPGARAAPERLGSGVHDADPWATPPYCP
KIQSPPYSSQGTTSDASLWTPPQSCPWTQPSPEPRNPPAPWTTPPATLELATVYQGLSVS
PESCLSLGTPSLLPHPSCQRLQPQTPWGCWSHSTEVLPTSEDQGQGAAFQLSEASPPQSS
ALRFSGCPELWQEDLEGARVSIFY
Download sequence
Identical sequences F7FI18
ENSCJAP00000013156 ENSCJAP00000044589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]