SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FIN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FIN3
Domain Number 1 Region: 46-107
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FIN3
Sequence length 217
Comment (tr|F7FIN3|F7FIN3_CALJA) KH domain containing 3 like, subcortical maternal complex member {ECO:0000313|Ensembl:ENSCJAP00000018291} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=KHDC3L OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MDTPRRFPTLVQLMQPKAMSFEVLGQLPKQFSWFHSEFLKNPKVVRLEVWLVEKIFGRGG
ERIPQVQGLSQILIHVNHLDPSGEAEILIFGRPSYQEDTIKMIVNLADYHRQLQAKGSGK
ALAQDIATQKAETQRSSIEVREAGTQRSVEVREAWTQRSVEVREVGTQGSPVEVREAGTQ
QSLKAASESGTQRSPEAASKARTQRFYVDARDPVTRL
Download sequence
Identical sequences F7FIN3
ENSCJAP00000018291 ENSCJAP00000045230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]