SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FK53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FK53
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000136
Family EGF-type module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FK53
Sequence length 208
Comment (tr|F7FK53|F7FK53_MACMU) Proheparin-binding EGF-like growth factor {ECO:0000313|EMBL:AFE66818.1} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=HBEGF OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKLLPSVVLKLLLAAVLSALVTGESLQQLRRGLAAGTSNPDPSTGSTDQLLRLGGGRDRK
VRDLQEADLDLLRVTLSSKPQALATPSKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE
CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG
LLMFRYHRRGGYDVENEEKVKLGMTNSH
Download sequence
Identical sequences A0A2K5VHS5 A0A2K6BF90 F7FK53
ENSMMUP00000004371 ENSMMUP00000034036 9544.ENSMMUP00000034036 NP_001244398.1.72884 XP_005558014.1.63531 XP_011714646.1.29376 ENSMMUP00000004371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]