SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7FL37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FL37
Domain Number 1 Region: 12-117
Classification Level Classification E-value
Superfamily Nucleoplasmin-like core domain 3.14e-44
Family Nucleoplasmin-like core domain 0.0000037
Further Details:      
 
Weak hits

Sequence:  F7FL37
Domain Number - Region: 160-191
Classification Level Classification E-value
Superfamily ARM repeat 0.000193
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 210-292
Classification Level Classification E-value
Superfamily HRDC-like 0.0262
Family RNA polymerase II subunit RBP4 (RpoF) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FL37
Sequence length 296
Comment (tr|F7FL37|F7FL37_CALJA) Nucleophosmin isoform 1 {ECO:0000313|EMBL:JAB19490.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NPM1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIV
EAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVE
EDAESEDEEEEDVKLLSMSGKRSAPGGGSKVPQKKVKLAADEDDDDDEDDDDDDDEDDDD
DDFDDEETEEKVPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTP
KGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Download sequence
Identical sequences F7FL37
XP_002744589.1.60252 ENSCJAP00000035920 ENSCJAP00000035924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]