SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FLI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7FLI7
Domain Number - Region: 2-28
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000672
Family Chromo domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FLI7
Sequence length 492
Comment (tr|F7FLI7|F7FLI7_MACMU) Uncharacterized protein {ECO:0000313|EMBL:EHH25267.1} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_09058 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
RHNSWEPEENILDPRLLLAFQKKEHEKEVQNRKRGKRPRGRPRKLTAMSSCSRRSKLKEP
DAPSKSKSSSSSSSSTSSSSSSDEEDDSDLDAKRGPRGRDTHPVPQKKAQILVAKPELKD
PIRKKRGRKPLPPEQKATRRPVSLAKVLKTARKDLGAPASKLPPPLSAPVAGLAALKAHA
KEACGSPSAMATPENLASLMKGMASSPGRGGISWQSSIVHYMNRMTQSQAASRLALKAQA
TTKCGLGLDLKVRTQKGELGMSPPGSKIPKAPSSGAVEQKVGSTGGPTHTHGASRIPAGC
PGPQSAPTQELSLQVLDLQSVKNGMPGVGLLARHATATKGVPATNPVPGKGTGGGLIGGS
GAAMPTDTSKSEKLASRAVAPPTPASKRDYVKGSATPSGQESRTAPGEARKAATLPEMSA
GEESSSSDSDPDSASPPSTGQNPSVSVQTSQDWKPTRSLIEHVFVTDVTANLITVTVKES
PTSVGFFNLRHY
Download sequence
Identical sequences F7FLI7 G7PT27
9544.ENSMMUP00000021561 ENSMMUP00000021561 ENSMMUP00000021561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]