SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FLK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FLK3
Domain Number 1 Region: 81-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.21e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000352
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.33e-19
Family Glutathione S-transferase (GST), N-terminal domain 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FLK3
Sequence length 222
Comment (tr|F7FLK3|F7FLK3_MACMU) Uncharacterized protein {ECO:0000313|Ensembl:ENSMMUP00000033536} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=GSTA2 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MAEKPKLYYYNARGRMESTRWLLAAAGVEFEEKFLESAEDLDKLRNDGYLMFQQVPMVEI
DGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIADLGEMILLLPFCQPEDKDAN
TALIKEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPL
LKALKTRISNLPTVKKFLQPGSPRQPPMNAKSLEESRKIFRF
Download sequence
Identical sequences A0A2K5UYC3 F7FLK3
ENSMMUP00000033535 ENSMMUP00000023142 NP_001182706.1.72884 XP_014991963.1.72884 XP_015304304.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]