SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FMN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FMN3
Domain Number 1 Region: 74-135
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000545
Family ComEA-like 0.042
Further Details:      
 
Weak hits

Sequence:  F7FMN3
Domain Number - Region: 196-290
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0432
Family Mitochondrial resolvase ydc2 catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FMN3
Sequence length 370
Comment (tr|F7FMN3|F7FMN3_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000028829} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
KHMNSNELCDPFFSILGKWKHFPVMMCPSLYHSLHMSCCQRKSIAPVKKTDFVSVSSDES
LKDTGKRLEDLYSSEEKSAILQVLNTASVNELGAFTFLRGRKSINIVKHREKHGPFQDLE
SLMEVPLFQYKSTVKVCDSILHPESKEKKKEKKILENSLGKFVRLGIERKKLKAAKSIVS
IVFGNERIAWAHLDNTVMVLDWRQENNFKLMKETYMPAMYLKMISSVVSKIPEADFYILE
KRTFSLQQTTLFPVTLHFHIVEAMLYSLLNKTFAQDGQHRVLSMNRNVVGKHFDLMLGTM
RTSGMALVQQFLSDFPKQEKPRVSFPLENLVRYRSMMETDGRKIKEELWDSLLQAVAFYE
LFIEGGERKC
Download sequence
Identical sequences F7FMN3
13616.ENSMODP00000028829 ENSMODP00000028829 ENSMODP00000028829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]