SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FNQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FNQ2
Domain Number 1 Region: 114-175
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.91e-16
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 172-241
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000761
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  F7FNQ2
Domain Number - Region: 84-112
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000234
Family LIM domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FNQ2
Sequence length 276
Comment (tr|F7FNQ2|F7FNQ2_MACMU) Filamin binding LIM protein 1 {ECO:0000313|Ensembl:ENSMMUP00000040577} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=FBLIM1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MASKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWAPPAPVKTPEAGLARRP
SPWTPPGKAATTVPAAPLQLSNGDICAFCHKTVSPRELAVEAMKRQYHAQCFTCRTCRRQ
LAGQSFYQKDGRPLCEPCYQDTLEKCGKCGEVVQDHIIRALGQAFHPSCFTCVTCARCIG
DESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCED
CRILLSVEPTDQGCYPLNNRLFCKPCHVKRSAAGCC
Download sequence
Identical sequences A0A2K5VP85 F7FNQ2
ENSMMUP00000040577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]