SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FPP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F7FPP0
Domain Number - Region: 30-107
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0194
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7FPP0
Sequence length 132
Comment (tr|F7FPP0|F7FPP0_ORNAN) Intraflagellar transport 20 {ECO:0000313|Ensembl:ENSOANP00000019321} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN=IFT20 OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MAKDALGDAGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIGQFQKIVGGLIELVDQ
LARDAESEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKMQLERYRVEYEALCKVEAE
QNEFIDQFIFQK
Download sequence
Identical sequences F7FPP0
XP_001507372.2.37387 ENSOANP00000019321 ENSOANP00000019321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]