SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FSQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FSQ0
Domain Number 1 Region: 28-135
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-19
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FSQ0
Sequence length 140
Comment (tr|F7FSQ0|F7FSQ0_MONDO) Uncharacterized protein {ECO:0000313|Ensembl:ENSMODP00000038644} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN= OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
SSWPYPYSCFLVLTLSLSDSSQGQEEFQVLQTKEPVSVAKGGKVTLNCTILENSPPGPVK
WFKGAGPQRKEIYNFKGGSYPRIKAVVPSSHTDFSISISNITPEDTGTYYCVKFKRGNPD
TEFKSGGGTMLSVSGPKSSI
Download sequence
Identical sequences F7FSQ0
ENSMODP00000038644 ENSMODP00000038644 13616.ENSMODP00000038644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]