SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FT20 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FT20
Domain Number 1 Region: 465-591
Classification Level Classification E-value
Superfamily PH domain-like 1.53e-29
Family Pleckstrin-homology domain (PH domain) 0.00000424
Further Details:      
 
Domain Number 2 Region: 114-268
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-26
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 273-334
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000907
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 4 Region: 2-68
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000157
Family Spectrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FT20
Sequence length 648
Comment (tr|F7FT20|F7FT20_ORNAN) Uncharacterized protein {ECO:0000313|Ensembl:ENSOANP00000004020} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN= OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
MLRDKFREFSRDTSNIGQERVDGANQLADGLIAGGHADRATVAEWKDGLNEAWADLLELL
DTRGQVLAARLYELQRLPCTEPAKVLGPVVDSIIIIEDSRWCWAPCVRGVSCDVQQVQED
GRRLQKAYAGEKAEEIGRHMKAVAEAWAQLQGSSAGRRQLLLDTGDKFRFLKAVRELMLW
MDGVNLQIDAQERPRDVSSADLVIKNHQGIKAEVEARADCFSSCITMGQELLTKNHYAAE
EILEKLSQLRARRQETANKWQEKMNWLQLVLEVLVFGRDAGVAEAWLCSQEPLVRSAELG
CTVDEVESLIKRHEAFQKAAVAWEERFSALEKLTALEKEQQQRREEEERRRKPPTPEPVI
SLPPEDLDDQPVPAVPWNGNHPRLPSSLEPLTVNGVCAEAESPQLLSEQQRFGIGQFPRR
PLSDMAGATNGPWGERPGWARGPAPSPMPRGRGPEPAHSATMTPRGPELSAQEQMEGMLY
RKQEMEALGKKAANRAHPRSWQAVYCVLRRGNLGFYKDARAAGLGVPYHGEVPVSLARAQ
GSVALDYRKRKHVFKLGCLQDGKEYLFQAKDEAEMSSWLRVVNASIAAASPDPVEPEELG
PSASRGMTRAMTMPPVLPTGAEGPVTLRTKDGKEREREKRFSFFKKNK
Download sequence
Identical sequences F7FT20
9258.ENSOANP00000004020 ENSOANP00000004020 ENSOANP00000004020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]