SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FT66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FT66
Domain Number 1 Region: 432-654
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-56
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 220-351
Classification Level Classification E-value
Superfamily BRCT domain 3.05e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.043
Further Details:      
 
Domain Number 3 Region: 135-247
Classification Level Classification E-value
Superfamily BRCT domain 7.12e-19
Family DNA ligase 0.029
Further Details:      
 
Domain Number 4 Region: 645-790
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000369
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FT66
Sequence length 912
Comment (tr|F7FT66|F7FT66_MONDO) Epithelial cell transforming 2 {ECO:0000313|Ensembl:ENSMODP00000026648} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ECT2 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MADNSILVSTAGKSLLADTSIFDSKVSEISKENEFIGSAEEEMPQIETRVILVQEAGKQE
ELIRALKTIKIMEVPVIKIKESCSGKTGEKLIKSIINMEIKVPYLMIESMEEFEDSDSAE
FENIFVVMDFQDAIFNNLYKADCRVLGPPIVLNCAQKGEPLPFSCRPLYCASMLNLVLCF
TGFRKKEELVKLVTLAHHMGGTIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKPEWI
FKAWERRNEQDFCAAADEFGNEFKVPPFQDCMLSFLGFSDEERANMEEMTEMQGGHCLPV
GDEQCTHLIVEENAIKELPFEPSKKLYVVKQEWFWGSIQMDARAGESMYLYEKANTPELK
KSVSLLSLSTPNSNRKRRRLKETLAQLARETDISPFPPRKRPSAEHSLSIGSLLDISNTP
ESSSNYGETPKSCTKPSKNSTPVPPKQSARWQVAKELYQTESNYVDILATIIQLFQIPLE
EEGQRGGPILAPEEIKAIFGSIPDIFDVHTKIKEDLEDLIINWDESKSIGDIFLKYSKDL
VKIYPPFVNFFEMSKETIVKCEKQKPRFHAFLKINQAKPECGRQSLAELLIRPVQRLPSV
ALLLNDLKKHTSDDNPDKNTLERAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDGCPA
NLLSSHRSLVQRVETISLGEYPCDRGEQVTLFLFNDCLEIARKRHKVIGTFKSPHGHTRP
PAALKHIHLMPLSQIKKVLDIKETEDCHNAFALLVRPPTEQANVLLSFQMTSEDLPKDTW
LKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKRVTRAFSF
TKTPRRAFRRALMSSQSSVEGRSPCAGGDTYLGGRLSSTSSLAGIPSPSLVSLPAFFEKR
SHTLSRSTTHLI
Download sequence
Identical sequences F7FT66
ENSMODP00000026648 ENSMODP00000026648 XP_003341918.1.35504 XP_007502005.1.35504 XP_007502006.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]