SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FTM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FTM4
Domain Number 1 Region: 1258-1372
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-34
Family Pleckstrin-homology domain (PH domain) 0.001
Further Details:      
 
Domain Number 2 Region: 1060-1240
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-20
Family DBL homology domain (DH-domain) 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FTM4
Sequence length 1513
Comment (tr|F7FTM4|F7FTM4_MONDO) Rho guanine nucleotide exchange factor 40 {ECO:0000313|Ensembl:ENSMODP00000008257} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ARHGEF40 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MEPEPVEDCVQSTLAALYPPFEATAPTLLGQVFQVVERTYREDALRYALDFLVPAKHLLA
RVQQEACAQYSGFLFLHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVIPSVARAPRLA
LKCLAPGGGRVQELPVSSEACAYLFTPEWLQGINKDRPAGRLTTCLLASPTGVQRLPWAE
LICPRFVHKGSLMVGQRPVSLPPELPPGPPGLSSPPLPEEALGTRSPGDGHNAPAEAPEG
EYVELLEVTLPARGCPEDTASSPSLSRTQTVPTRKGAGGKGRHRRHRAWLHQKGTVPRGQ
DGTRPPGEGSSAGVNTGSPPRVESPQEEGTLHAPELPAEAPGGEIGPFPLRPNEGGDGPG
QGEEGLAGTPRKSGKGNRRKKRGGGRGTPGQGAESVPSIPQNKEETSHPEALTSLVPQNE
KELSGFHLLQEEEPKCTGKTDPEQVKEEEPIPSSACESTEEGTGEAEPRGQSLAAAEVST
DPVELLSGPPVPPSKAGKEDKEDGSPEGCTSALANDDSNVTWDLMASGFFLLAGGVDQSG
RALLTITPPCPPTEPPPTQAEMRTALCYLHSLLRSDLKMLGLSVLLDLRGAPLLPPGLIP
VLNDLQDSREHPVKIQRLMILTENESATELSELQRAELLSESDLPTVAKPEELQKDLGGD
RDASAQRWTETHQEVARLCHLCHDVLGSVREATEELQRAVEPQGEVEGTPDPLRKVLADP
RLAELQRDGGAILMRLRAAHSSRLEGPGPALLYQEVDEAIHQLVRLSNLYLQRQENQRQR
HRLLQVLQWLSGPGEEQLMSFTELGDSLPALQETEIRFQAFSTEAQEQLAQAREALTLEE
DPTTQQALDDFEQRLEQVESSLHRALRLHRFFQQAHEWVDEGTAKLAGTGPGREAVLAAL
APVPSAGTFQEMRALALELGSPAALREWGRCHARCLELERRVQEFLGDETSPQGRCRRRA
DSTSSGGGRQGPLSPSWSLCSLLLPNSPGPRPAPSHCSLAPCGEDSEEETPELAPEAQSK
PRPGTTRAVLIRGLEVSSTEVVDRTCSPREHVLLGRAGVPDGPWGVGTPRMERKRSISAQ
QRLVSELISCEQEYVTVLGEPVPAPGPELTPDLRADWAAALAARERLRNFHRGHFLRELQ
GCTSHPLRVGACFLRHGDQFNLYAQYLKQRLKLEAGLAALSPPNKGSTEGSPYLPRFLQQ
PLEQLARYGKLLEELLKETGTEPSSERQALAAALQMLRDQEDRGRDLLAVEAVRGCEVDL
KEQGQLLHRDPFTVFCGRRKCLRHVFLFEHLLLFSKLKSPEGGPEVFVYKQAFKTADMGL
TENIGDSGLCFELWFRRRRSREAYTLQAPSSEIKHKWTSSIAQLLWRQAAHNKELRVQQM
VSMGIGNKPFLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPCLSPGACSLPA
RVEEEAWDLDIKQISLAPESPDSSGEVSPGARSSPSLQPPSLGSSTPIMPSGGILGFGRP
SHSRAPSDPTTPL
Download sequence
Identical sequences F7FTM4
ENSMODP00000008257 XP_007479831.1.35504 ENSMODP00000008257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]