SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FVR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FVR7
Domain Number 1 Region: 82-267,365-402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-59
Family Calnexin/calreticulin 0.0001
Further Details:      
 
Domain Number 2 Region: 239-369
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.1e-27
Family P-domain of calnexin/calreticulin 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FVR7
Sequence length 449
Comment (tr|F7FVR7|F7FVR7_MONDO) Calreticulin 3 {ECO:0000313|Ensembl:ENSMODP00000018657} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=CALR3 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MHHPVGGRSAQAQPVCKALRGLKFLSTSRNTAGSISGAPDRANQKAPPDRGREKKTHLRA
AMSRAKVPGPLWALWLMRAALATVYFQEEFLDGESWRNRWIPSTNDSKFGHFRLSSGKFY
GDIQKDKGLQTTENAKFYAISSRFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKIFPSEL
DQKNLNGKSQYYIMFGPDICGFDIKKVHVILFYKNQYHSNKKPIRCKVDGFTHLYTLTLR
PDLTYEVKIDTDIIESGSIEEDWNLQKIRRMEKSALKMPENWDKLSQNDKPSDDWDKHLL
DASANKPSDWNSELDGEWQPSVIQKPKHKDGLKLDNSDYKDVWLHKKIENPGYLQDFEFL
EYEDIGVIGLELWQVRSGTIFDNFLITDDENYAADFGLKTWGRTKDPEKEMDMIQAKEEI
KKAREEEEQLIRENIKEKYFQSQTAKDEL
Download sequence
Identical sequences F7FVR7
ENSMODP00000018657 ENSMODP00000018657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]