SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FWC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FWC2
Domain Number 1 Region: 322-395
Classification Level Classification E-value
Superfamily F-box domain 4.32e-16
Family F-box domain 0.0038
Further Details:      
 
Weak hits

Sequence:  F7FWC2
Domain Number - Region: 2-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00103
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FWC2
Sequence length 518
Comment (tr|F7FWC2|F7FWC2_MONDO) F-box protein 7 {ECO:0000313|Ensembl:ENSMODP00000001615} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=FBXO7 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MKLRVRVRKRTAPLELPGAEPTLGELRAHLRQALLPAWGYSSDIQFAVTLNSKDALTEDE
KTLAEYGIVCGDLICLVLEEATEDLPRASLDLAHSSFASNHDQPSLATSQSLRSRQGERE
LNDPYSAVQSAESMPGSSLDLDSGLIQEDVDMEEGTGGYPSEPMLCSEAVDGQVPHSLEM
LYHSAECSSTNDALIVLVHLLMLESGYIPLGTEAKAVSMPENWRSGGVYKLQYMHPLCED
GTAALTCVPLGSLIVINATLKINNEIRSVKRLQLLPESFICPPKQAEEQVASKYKDLQKL
SRLFKDQLVYPLLAFARQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLALSAVCRDLFN
ASNDQLLWRFMYLRDFRDGAVRPRDTDWKELYRKQKQRKDALRWRHAMFLPPPPHPMPFH
PSPFYPSPFPPNPMYPPGIIGGEFDERPVLPYVGDPINSLIPGPGEAPGQFSPFRPHFDP
MGPFPGPNPVLPGRGGPSDRFPFRPSRGRPTDIRLSFI
Download sequence
Identical sequences F7FWC2
ENSMODP00000001615 ENSMODP00000001615 XP_001366168.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]