SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FWH5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FWH5
Domain Number 1 Region: 22-148
Classification Level Classification E-value
Superfamily Lysozyme-like 5.36e-47
Family C-type lysozyme 0.0000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FWH5
Sequence length 159
Comment (tr|F7FWH5|F7FWH5_MACMU) Sperm acrosome-associated protein 5 {ECO:0000313|EMBL:EHH30691.1} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=EGK_20455 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MQAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGIGDWLCMAHYESGFD
TAFVDHNPDGSSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIMCAKQIVS
SQNGLSAWTSWRRHCSGHDLSEWLKGCDMNVKIDPKIHP
Download sequence
Identical sequences A0A080YV23 A0A096N1G1 A0A0D9RM89 A0A2K5M6R5 A0A2K5XJ56 A0A2K6C4K4 F7FWH5 G7Q2M1
ENSMMUP00000014266 ENSMMUP00000014266 9544.ENSMMUP00000014266 ENSPANP00000006133 XP_005593495.1.63531 XP_007989742.1.81039 XP_007989743.1.81039 XP_011709959.1.29376 XP_011838256.1.47321 XP_011925525.1.92194 XP_011925526.1.92194 XP_011925527.1.92194 XP_014982791.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]