SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FYL0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FYL0
Domain Number 1 Region: 506-694
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-53
Family DBL homology domain (DH-domain) 0.0000000155
Further Details:      
 
Domain Number 2 Region: 699-839
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-38
Family Pleckstrin-homology domain (PH domain) 0.000000192
Further Details:      
 
Domain Number 3 Region: 191-333
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000127
Family Spectrin repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 998-1049
Classification Level Classification E-value
Superfamily SH3-domain 0.00000647
Family SH3-domain 0.0026
Further Details:      
 
Weak hits

Sequence:  F7FYL0
Domain Number - Region: 21-104
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000102
Family CRAL/TRIO domain 0.0087
Further Details:      
 
Domain Number - Region: 344-434
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00184
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FYL0
Sequence length 1093
Comment (tr|F7FYL0|F7FYL0_ORNAN) MCF.2 cell line derived transforming sequence like {ECO:0000313|Ensembl:ENSOANP00000024650} KW=Complete proteome; Reference proteome OX=9258 OS=Ornithorhynchus anatinus (Duckbill platypus). GN=MCF2L OC=Mammalia; Monotremata; Ornithorhynchidae; Ornithorhynchus.
Sequence
FSLQDAGIGFILVIDRRQDRWSSVKASVLRIAASFPGNLQLVLVLRPTGFFQRALSDIAF
KFNRDDFKMKVPVIMLSSVPELHSYIDKTQLTEDLGGTLDYCHSSWLSHRTAIENFALMV
KQTAQMLQSFGTELAETELPNDGPSTSLVLMAHTEKKDKMKEDMMLAVKEGQTILESIRE
PLREKPECNLNQGQLDNQTTMERLLAQLDETEAAFDEFWAKHQRKLEQCLQLRNFEQNFR
EVKAALDVVSERLSAFTDVGNSYAHVEHILKDLLSFEEKANECIEKARALCSEATQLIED
KHYAVDSILPKCDELQHLCDDFTNEMEKQKALLSKSLELHGLLEKSMKWCDEGIYLLASQ
PVDRCQSQDGAESALQEIEKYLDTGAENKIQELNEVYKEYESILSPDLMEHVQKVFQKQE
SMEEMFQKRQASLKKLAAKQTRPVQPVAPRPEAFAKSPCTSPSLRRGSERSSSPDGSVLR
RVNYRRIKSDTSVVQQGRGSSAMDDQENLTILRRHVMNELLETERAYVDELLCVLEGYAA
EMENPLMTHLIPPGLQNKKDVLFGNMEEIYHFHNRIFLRELENYIDYPELVGRCFLERME
DFQIYEKYCQNKPRSESLWRQWSDSAFFQECQRKLDHKLSLDSYLLKPVQRITKYQLLLK
EMLKYSKNCDGSEDLQEALTSILGILKAVNDSMHLIAITGYDGNLNELGKLLMQGSFSVW
TDHKKGHAKVKDLARFKPMQRHLFLHEKAVLFCKKREENGEGYEKAPSYSYKQSLNMAAV
GITENVKGDNRKFEIWYNAREEVYIIQAPTPEIKATWVNEIRKVLTSQLQAYREASQHRA
LEQSQSLPLAASSNTSPSRNHTRKVRKPEESKTNRMSLEGCIGSGTAPKFPDKDKVDESL
TSSTSERSALSKKHFTLQGFANLKNQKASPTGPDKKAKRHEVKSDPTPLGLRGWTRTGPS
QDTSEENDCWSSAEDPLNSSDEDGATAVGPKKLVPGKYSIVADPENGGTDVLAVKSGDLV
ELISEGTERQWYVRNLTTSREGWIPTGSLSALIGNSKSAQSLASSDSGAGAAILSSSSSC
SEGGSVPFSDNKG
Download sequence
Identical sequences F7FYL0
ENSOANP00000024650 9258.ENSOANP00000024650 ENSOANP00000024650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]