SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FZE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FZE7
Domain Number 1 Region: 1083-1292
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-52
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 1761-1999
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000159
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 3 Region: 1289-1382
Classification Level Classification E-value
Superfamily PH domain-like 0.000000258
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7FZE7
Sequence length 2082
Comment (tr|F7FZE7|F7FZE7_MONDO) Rho guanine nucleotide exchange factor 17 {ECO:0000313|Ensembl:ENSMODP00000009509} KW=Complete proteome; Reference proteome OX=13616 OS=Monodelphis domestica (Gray short-tailed opossum). GN=ARHGEF17 OC=Mammalia; Metatheria; Didelphimorphia; Didelphidae; Monodelphis.
Sequence
MTDGPPPPPLYRSISFKRLERWSGGPGSDRADCVEETTSSSPGLRRRAPGTATLAASRRV
SKLASGGSRSAATSSPRPLRSLSPSVRQLSQRFDCAGRGSRSRSRSQSHIPGTDSPNEEE
AHWMRGREGAPSELRRGQLASEEGAGVGGGGPGSEPSGHWPSVTEMSKLFGGQNYRRPSP
DGLWGSSSPASASPTRDDGAQSPEEPPSRHQPPPPPPRTCFPLSGLRSPLPRAQAEGRRQ
QQADSSHSWHSYCQPHAGPQASVCSSSSSPATAFYPVSQSLSRGESSSEEEDQAGGPGIS
AAPSPGAQPSGGSGSEGDQLKEEGKLQASSYRKEASAGRWDLDNDGLKPGRMDSSEWTPE
GQGLDPQRPGCVSESPQASGGSQEGLRQLTRGLPDSFGSTFPMVSRVAKVSFPPYVASLG
RHSSTEKLKEEDLWTGRGSWGLYRSPSFGTGDGFLRPQTHARPKPLVCMGKGQRDSPTEA
LEPSYKAMELEKSRQRKSLSNPDIASETLTLLSFLRSDLSELKVRRSGRRPGDHDGAPQS
CSDASEDNELAGHRGPLLVPAKQVLGTRPTLKDLTATLRRAKSFSCSETPSPRRLSRTGA
LKPSSSELLLARRRAEEEDEEDGLPEVVQDQYVQEARQVFEKISQMGAQRDDGGSPPALH
LPSSSPCRRSLEELSGHESSLTDEGIVTEPEPASIAYRGLGPLSEWKSGEFPLSSSRINP
SGPQAEGGRVPPTGPLDAPGTPGALRRRRKGPPIGLGGTDLSNGEAGEAYRSLSDPMPHH
RRPAPFEESSGFSVDSNLLGSLGPKAGLPTASAVALVDCGVGGASDSSIGSDGGKDFQEV
IQSVVHQPGALGRAVDERTHGRAAKKKSLSDPSRRGQQAGSGFEGPGGEPILEAALPPAS
SEPILLEHQSGEPGKTRAQSERVLPKTLPATTPLDFRLDPKLADVLSPRLARRGSKKRPA
RSSHQEFRKEEDSATLGRAHSGSRHVRHASEPAAFIPIEAPEPKATGTGPSGSTNKVYPA
LHVPSLEDVTKQYMLTLHSSESPAPGPTDVSPSTPATPTSTEAKPLEVARPPEDPVAAER
RQSQSKPQVDMRKHVIMTLLDTEQSYVESLRTLMQGYMQPLKQPENAVLCDPSLVDEIFD
QIPELLEHHEQFLEQVQNRVQEWHTRQKVGDLLVQSFSKDILVNIYSAYIDNFLNAKDAV
RIAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDRP
FLIDAHRNIKQVAERINKGMKNAEEVERHARVLLEIEAHIEGMEDLQAPLRRFLRQEMVV
EVKAVGGKKDRSLFLFSDLLVCTTLKRKSGSLRRSSMSLYTAASVIDIASKYKLLWKLPL
EDADIIKGASHATNRESVQKAISHLDEDLNTLGQISKLSETLSFPHQSLDDVIKELTAAA
HRDLAEKQALCYTLSFPPNKVELSATRPEGTDTFIFEFPHPDARVGFEQAFDEAKRKLAS
SKNCLDPEFLKAIPIMKTRSGMQFSCASPSHSTCAESAHEVWVCNSDGYVGQVCLLSLRA
EPTVEACIAVCSARILCMGSVPGLQPGGGGGGGSNGFRDQPPSLVSPASPPEVVATAAAL
DEGSSQPCLHISISGSSPELPPGPTNSTPGPELMPFDSDDSDDESSPSPSGTLQSQASRS
TISSSFGNEEMPSSKEATAETTSSEEEPEPGFLPLSGSFGPSGPHGGSPVDGRALRRSSR
GSFTRGSLEDLLSMDPEAYQSSMWLGTEDGCIHVYQSSDSIRNRKNSMKLQHAAAVTAIM
YLDNQVFVSLANGELVVYNREAGHFWDPQNSKSLVLGSPGSPVTKMVSVSGKLWCGCQNR
IFVLNTGSLQQEHAFQVGLDPNRSVACMVNSSLGVWIALQSTAQVRLYHSGTFEQLAEVD
ITPPVHKMLAGSDAIIRQHKAACLRITALLACEDLLWIGTSAGVVLTMPTSPNTVSTPRA
PLSPAGLVQGHTGHVRFLTAIELPDNFDLLCPPPAHDASPEKSALLERRDSSRHRGSAPA
LVKPKMLVISGGDGYEDFRLSSSSSETVGRDDSTNHLLLWRV
Download sequence
Identical sequences F7FZE7
ENSMODP00000009509 ENSMODP00000009509 XP_007491077.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]