SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F7FZG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7FZG8
Domain Number 1 Region: 92-166
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.06e-18
Family HLH, helix-loop-helix DNA-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7FZG8
Sequence length 242
Comment (tr|F7FZG8|F7FZG8_CALJA) Myogenic factor 6 {ECO:0000313|Ensembl:ENSCJAP00000035903} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=MYF6 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MMMDLFETGSYFFYLDGENVTLQPLEAAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEE
HVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRT
VANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDAFSYRPKQENLEGADFL
RTCSSQWPSVSDHSRGLVITAKEGGASTDSSASSSLRCLSSIVDSISSEERKLPCVEEVV
EK
Download sequence
Identical sequences F7FZG8
ENSCJAP00000035903 ENSCJAP00000035903 XP_002752845.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]