SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7G3P2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7G3P2
Domain Number 1 Region: 395-561
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-27
Family Toll/Interleukin receptor TIR domain 0.00073
Further Details:      
 
Domain Number 2 Region: 252-349
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000113
Family I set domains 0.04
Further Details:      
 
Domain Number 3 Region: 161-236
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000102
Family I set domains 0.032
Further Details:      
 
Domain Number 4 Region: 38-137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000038
Family I set domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7G3P2
Sequence length 696
Comment (tr|F7G3P2|F7G3P2_MACMU) Interleukin-1 receptor accessory protein-like 1 {ECO:0000313|EMBL:AFE64417.1, ECO:0000313|Ensembl:ENSMMUP00000002234} KW=Complete proteome; Reference proteome OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=IL1RAPL1 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MKAPIPHLILLYATFTQSLKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYI
RANYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVI
RNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEIL
WYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFIVRRTTELTVTAPLTDK
PPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWE
SDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYTVEL
AGGLGAILLLLVCLVTIYKCYKIEIMLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWN
QETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPN
YVVRRGWSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLTVIKWH
GPKCNKLNSKFWKRLQYEMPFKRIEPITHEQALDVSEQGPFGELQTVSAISMAAATSTAL
ATAHPDLRSTFHNTYHSQMRQKHYYRSYEYDVPPTGTLPLTSIGNQHTYCNIPMTLINGQ
RPQTKSSREQNPDEAHTNSAILPLLPRETSISSVIW
Download sequence
Identical sequences A0A096N6P1 A0A2K5WTU5 F7G3P2
ENSMMUP00000002234 XP_005593280.1.63531 XP_014982609.1.72884 9544.ENSMMUP00000002234 ENSMMUP00000002234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]